DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab11 and RABA6b

DIOPT Version :9

Sequence 1:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_173258.2 Gene:RABA6b / 838399 AraportID:AT1G18200 Length:229 Species:Arabidopsis thaliana


Alignment Length:226 Identity:115/226 - (50%)
Similarity:155/226 - (68%) Gaps:22/226 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAG 69
            ::|.|||||.||||||.||||||||||:|:||.|:||.||||:||.|::.|..||||||||||||
plant     7 DEECDYLFKAVLIGDSAVGKSNLLSRFSRDEFRLDSKPTIGVDFAYRNVRVGDKTIKAQIWDTAG 71

  Fly    70 QERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRHLRSV 134
            |||:|||||:|||||:||||:|||.:.:|::|:|:||.|||..:....|::||||||||...|.|
plant    72 QERFRAITSSYYRGALGALLIYDITRRITFKNIEKWLSELRGFSSPETVVVLVGNKSDLGQSREV 136

  Fly   135 PTDEAKLFAERNGLSFIETSALDSTNVETAFQNILTEIYRIVSQKQIRD---------------- 183
            ..:|.|..||..||.|:|||||::.|||.||.:::..|:.:::||.:.|                
plant   137 EEEEGKTLAESEGLYFLETSALENQNVEEAFLSMIGRIHEVLTQKIVLDNRLNGDGNNESNGAVV 201

  Fly   184 PPEGDVIRPSNVEPID-VKPTVTADVRKQCC 213
            ||..:::   |:..:. .:|..|:  ...||
plant   202 PPGKEIV---NIHEVTATRPLSTS--LSNCC 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 103/163 (63%)
RABA6bNP_173258.2 Rab11_like 11..175 CDD:206660 103/163 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133775at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.