DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab11 and RAB11c

DIOPT Version :10

Sequence 1:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_172434.1 Gene:RAB11c / 837490 AraportID:AT1G09630 Length:217 Species:Arabidopsis thaliana


Alignment Length:209 Identity:144/209 - (68%)
Similarity:175/209 - (83%) Gaps:0/209 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAG 69
            ::||||||||||||||||||||||||||||||.||||||||||||||:::|:|:|:|||||||||
plant     6 DEEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFCLESKSTIGVEFATRTLQVEGRTVKAQIWDTAG 70

  Fly    70 QERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRHLRSV 134
            |||||||||||||||:|||||||:.|..|:|||.|||:|||||||.||||||:|||:||:|||:|
plant    71 QERYRAITSAYYRGALGALLVYDVTKPTTFENVSRWLKELRDHADSNIVIMLIGNKTDLKHLRAV 135

  Fly   135 PTDEAKLFAERNGLSFIETSALDSTNVETAFQNILTEIYRIVSQKQIRDPPEGDVIRPSNVEPID 199
            .|::|:.:||:.||||||||||::.|||.|||.||:|:|||:|:|.|..............:.||
plant   136 ATEDAQSYAEKEGLSFIETSALEALNVEKAFQTILSEVYRIISKKSISSDQTTANANIKEGQTID 200

  Fly   200 VKPTVTADVRKQCC 213
            |..|..::.:|.||
plant   201 VAATSESNAKKPCC 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 129/163 (79%)
RAB11cNP_172434.1 P-loop containing Nucleoside Triphosphate Hydrolases 1..216 CDD:476819 144/209 (69%)

Return to query results.
Submit another query.