DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab11 and ARA-2

DIOPT Version :9

Sequence 1:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_172128.1 Gene:ARA-2 / 837151 AraportID:AT1G06400 Length:216 Species:Arabidopsis thaliana


Alignment Length:209 Identity:140/209 - (66%)
Similarity:169/209 - (80%) Gaps:1/209 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAG 69
            ::|||||||:||||||||||||||||||:|||||||||||||||||::.:|:||.:|||||||||
plant     7 DEEYDYLFKLVLIGDSGVGKSNLLSRFTKNEFNLESKSTIGVEFATKTTKVEGKVVKAQIWDTAG 71

  Fly    70 QERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRHLRSV 134
            ||||||||||||||||||||:||:.:|.|:||..|||||||.|.|.|||:||:|||.|||||.:|
plant    72 QERYRAITSAYYRGAVGALLIYDVTRHATFENAARWLRELRGHTDPNIVVMLIGNKCDLRHLVAV 136

  Fly   135 PTDEAKLFAERNGLSFIETSALDSTNVETAFQNILTEIYRIVSQKQIRDPPEGDVIRPSNVEPID 199
            .|:|||.||||..|.|:||||||:||||.||..:||:|::|||::.:....|...: |...|.|:
plant   137 KTEEAKAFAERESLYFMETSALDATNVENAFTEVLTQIHKIVSKRSVDGGGESADL-PGKGETIN 200

  Fly   200 VKPTVTADVRKQCC 213
            ||...:...|..||
plant   201 VKEDGSVLKRMGCC 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 125/163 (77%)
ARA-2NP_172128.1 Rab11_like 11..175 CDD:206660 125/163 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0087
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 296 1.000 Inparanoid score I808
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133775at2759
OrthoFinder 1 1.000 - - FOG0000259
OrthoInspector 1 1.000 - - otm2982
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47979
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X277
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.930

Return to query results.
Submit another query.