DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab11 and RABA4a

DIOPT Version :9

Sequence 1:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_201330.1 Gene:RABA4a / 836652 AraportID:AT5G65270 Length:226 Species:Arabidopsis thaliana


Alignment Length:217 Identity:121/217 - (55%)
Similarity:166/217 - (76%) Gaps:5/217 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GAREDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWD 66
            |....:.||:|||||||||.||||.:|:|:.|:||:|:||:||||||.||::.:|.|::||||||
plant     8 GDPSQKIDYVFKVVLIGDSAVGKSQILARYARDEFSLDSKATIGVEFQTRTLVIDHKSVKAQIWD 72

  Fly    67 TAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRHL 131
            |||||||||:|||||||||||:|||||.:..|::::.|||.|||.|||:||||:|:||||||...
plant    73 TAGQERYRAVTSAYYRGAVGAMLVYDITRRQTFDHIPRWLEELRAHADKNIVIILIGNKSDLVDQ 137

  Fly   132 RSVPTDEAKLFAERNGLSFIETSALDSTNVETAFQNILTEIYRIVSQKQIRDPPEGDVIRPSNV- 195
            |::||::||.|||:.||.|:||||.::||||:||..:||||:.||::|.:....:.:...|.:: 
plant   138 RAIPTEDAKEFAEKEGLFFLETSAFNATNVESAFSTVLTEIFNIVNKKSLAASEDQENGNPGSLA 202

  Fly   196 -EPIDVKP---TVTADVRKQCC 213
             :.||:.|   .|..:....||
plant   203 GKKIDIVPGPGQVIPNKSNMCC 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 109/163 (67%)
RABA4aNP_201330.1 Rab11_like 15..179 CDD:206660 109/163 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133775at2759
OrthoFinder 1 1.000 - - FOG0000259
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.