DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab11 and RABA1f

DIOPT Version :10

Sequence 1:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_200894.1 Gene:RABA1f / 836207 AraportID:AT5G60860 Length:217 Species:Arabidopsis thaliana


Alignment Length:215 Identity:149/215 - (69%)
Similarity:173/215 - (80%) Gaps:12/215 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAG 69
            :|||||||||||||||||||||||||||||||:||||||||||||||||.||.|.:|||||||||
plant     7 DDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSIHVDDKIVKAQIWDTAG 71

  Fly    70 QERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRHLRSV 134
            |||||||||||||||||||||||:.:|:|:|||||||:|||||.|.|||||.||||:||||||:|
plant    72 QERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDANIVIMFVGNKADLRHLRAV 136

  Fly   135 PTDEAKLFAERNGLSFIETSALDSTNVETAFQNILTEIYRIVSQKQI---RDP---PEGDVIRPS 193
            .|::||.||||....|:|||||:|.|||.||..:|::|||:||:|.:   .||   |:|..|.  
plant   137 STEDAKAFAERENTFFMETSALESMNVENAFTEVLSQIYRVVSRKALDIGDDPAALPKGQTIN-- 199

  Fly   194 NVEPIDVKPTVTADVRKQCC 213
                :..|..|:|..:..||
plant   200 ----VGSKDDVSAVKKVGCC 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 130/163 (80%)
RABA1fNP_200894.1 Rab11_like 11..175 CDD:206660 130/163 (80%)

Return to query results.
Submit another query.