DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab11 and RABA2D

DIOPT Version :9

Sequence 1:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_200723.1 Gene:RABA2D / 836033 AraportID:AT5G59150 Length:217 Species:Arabidopsis thaliana


Alignment Length:211 Identity:140/211 - (66%)
Similarity:170/211 - (80%) Gaps:3/211 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAG 69
            |.:||||||:||||||||||:|:|||||||||.||||||||||||||:::|:|||:|||||||||
plant     6 EQDYDYLFKIVLIGDSGVGKTNILSRFTRNEFCLESKSTIGVEFATRTLQVEGKTVKAQIWDTAG 70

  Fly    70 QERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRHLRSV 134
            ||||||||||||||||||||||||.|..|::||.|||||||||||.|||||:.|||:||.|||||
plant    71 QERYRAITSAYYRGAVGALLVYDITKRQTFDNVLRWLRELRDHADSNIVIMMAGNKADLNHLRSV 135

  Fly   135 PTDEAKLFAERNGLSFIETSALDSTNVETAFQNILTEIYRIVSQKQI--RDPPEGDVIRPSNVEP 197
            ..::.:..||..||||:|||||::||||.|||.:|.|||.|:|:|.:  ::....:...|.....
plant   136 AEEDGQTLAETEGLSFLETSALEATNVEKAFQTVLAEIYHIISKKALAAQEAAAANSAIPGQGTT 200

  Fly   198 IDVKPTVTADVRKQCC 213
            |:|:.|..|. ::.||
plant   201 INVEDTSGAG-KRGCC 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 126/163 (77%)
RABA2DNP_200723.1 PLN03110 1..217 CDD:178657 140/211 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0087
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133775at2759
OrthoFinder 1 1.000 - - FOG0000259
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X277
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.780

Return to query results.
Submit another query.