DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab11 and RABA4C

DIOPT Version :9

Sequence 1:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_199607.1 Gene:RABA4C / 834847 AraportID:AT5G47960 Length:223 Species:Arabidopsis thaliana


Alignment Length:208 Identity:134/208 - (64%)
Similarity:164/208 - (78%) Gaps:3/208 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQERY 73
            ||:|||||||||.||||.||:||:||||::|||:||||||.||::|:|.||||||||||||||||
plant    13 DYVFKVVLIGDSAVGKSQLLARFSRNEFSIESKATIGVEFQTRTLEIDRKTIKAQIWDTAGQERY 77

  Fly    74 RAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRHLRSVPTDE 138
            ||:|||||||||||:|||||.|..::::|.|||.|||.|||:||||||:|||:||..||:|||::
plant    78 RAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIVIMLIGNKTDLGTLRAVPTED 142

  Fly   139 AKLFAERNGLSFIETSALDSTNVETAFQNILTEIYRIVSQKQIRDPPEGDVIRPSNV---EPIDV 200
            ||.||:|..|.|:|||||||.|||.:|..:|||||||||:|.:....||:....|::   ..|.|
plant   143 AKEFAQRENLFFMETSALDSNNVEPSFLTVLTEIYRIVSKKNLVANEEGESGGDSSLLQGTKIVV 207

  Fly   201 KPTVTADVRKQCC 213
            ....|....|.||
plant   208 AGEETESKGKGCC 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 118/163 (72%)
RABA4CNP_199607.1 Rab11_like 13..177 CDD:206660 118/163 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133775at2759
OrthoFinder 1 1.000 - - FOG0000259
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X277
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.