DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab11 and RABA5a

DIOPT Version :9

Sequence 1:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_199563.1 Gene:RABA5a / 834802 AraportID:AT5G47520 Length:221 Species:Arabidopsis thaliana


Alignment Length:214 Identity:121/214 - (56%)
Similarity:157/214 - (73%) Gaps:5/214 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EDE--YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDT 67
            ||:  .|||||:||||||.|||||||:||.|:||...|||||||||.|:.::::||.||||||||
plant     6 EDDKSEDYLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEIKAQIWDT 70

  Fly    68 AGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRHLR 132
            |||||:||:|||||||||||||||||::..|:.::.|||.||..|:|.|:|.:||||||||:.||
plant    71 AGQERFRAVTSAYYRGAVGALLVYDISRRQTFHSIGRWLNELHTHSDMNVVTILVGNKSDLKDLR 135

  Fly   133 SVPTDEAKLFAERNGLSFIETSALDSTNVETAFQNILTEIYRIVSQKQI--RDPPEGDVIRPSNV 195
            .|.|.|.|..||..||.|:|||||||:||..||:.::.|||.|:|:|.:  ::..:.|....||.
plant   136 EVSTAEGKALAEAQGLFFMETSALDSSNVAAAFETVVKEIYNILSRKVMSSQELNKQDPASLSNG 200

  Fly   196 EPIDVKPTVTADVRK-QCC 213
            :.:.:......:.:| .||
plant   201 KKVVIPSDGQGEFKKGGCC 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 108/163 (66%)
RABA5aNP_199563.1 Rab11_like 12..176 CDD:206660 108/163 (66%)
RAB 15..178 CDD:197555 107/162 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133775at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.