DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab11 and RABA1e

DIOPT Version :9

Sequence 1:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_193578.1 Gene:RABA1e / 827574 AraportID:AT4G18430 Length:217 Species:Arabidopsis thaliana


Alignment Length:221 Identity:152/221 - (68%)
Similarity:180/221 - (81%) Gaps:14/221 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGA--REDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQ 63
            |||  .:|:||||||:||||||||||||||||||||||::||||||||||||||:.||.|.||||
plant     1 MGAYRADDDYDYLFKLVLIGDSGVGKSNLLSRFTRNEFSIESKSTIGVEFATRSVHVDEKIIKAQ 65

  Fly    64 IWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDL 128
            :|||||||||||||||||||||||||||||.:|:|:|||||||:|||||.|.|:||||||||:||
plant    66 LWDTAGQERYRAITSAYYRGAVGALLVYDITRHITFENVERWLKELRDHTDANVVIMLVGNKADL 130

  Fly   129 RHLRSVPTDEAKLFAERNGLSFIETSALDSTNVETAFQNILTEIYRIVSQKQI---RDP---PEG 187
            ||||:|||:||:.|:||..:.|:||||||:||||.||.::||:|||::|:|.:   .||   |:|
plant   131 RHLRAVPTEEARSFSERENMFFMETSALDATNVEQAFTHVLTQIYRVMSRKALDGTGDPMSLPKG 195

  Fly   188 DVIRPSNVEPIDVKPTVTADVRKQCC 213
            ..|...|      |..|||.....||
plant   196 QTIDIGN------KDDVTAVKSSGCC 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 130/163 (80%)
RABA1eNP_193578.1 Rab11_like 11..175 CDD:206660 130/163 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 267 1.000 Domainoid score I449
eggNOG 1 0.900 - - E2759_KOG0087
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 296 1.000 Inparanoid score I808
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133775at2759
OrthoFinder 1 1.000 - - FOG0000259
OrthoInspector 1 1.000 - - otm2982
orthoMCL 1 0.900 - - OOG6_100582
Panther 1 1.100 - - O PTHR47979
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X277
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.