DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab11 and RABB1C

DIOPT Version :9

Sequence 1:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_193450.1 Gene:RABB1C / 827428 AraportID:AT4G17170 Length:211 Species:Arabidopsis thaliana


Alignment Length:176 Identity:93/176 - (52%)
Similarity:118/176 - (67%) Gaps:5/176 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQER 72
            |.||||.::|||:|||||.||.:||...|......||||||..|.|.:|.|.||.|||||||||.
plant     3 YAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDNKPIKLQIWDTAGQES 67

  Fly    73 YRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRHLRSVPTD 137
            :|:||.:|||||.||||||||.:..|:.::..||.:.|.||:.|:.|||:|||.||.|.|:|.|:
plant    68 FRSITRSYYRGAAGALLVYDITRRETFNHLASWLEDARQHANANMTIMLIGNKCDLAHRRAVSTE 132

  Fly   138 EAKLFAERNGLSFIETSALDSTNVETAFQNILTEIYRIVSQKQIRD 183
            |.:.||:.:||.|:|.||..:.|||.||......||     |:|:|
plant   133 EGEQFAKEHGLIFMEASAKTAQNVEEAFIKTAATIY-----KKIQD 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 87/163 (53%)
RABB1CNP_193450.1 PLN03108 1..210 CDD:178655 93/176 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.