DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab11 and RABG3A

DIOPT Version :10

Sequence 1:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001154217.1 Gene:RABG3A / 826558 AraportID:AT4G09720 Length:217 Species:Arabidopsis thaliana


Alignment Length:176 Identity:62/176 - (35%)
Similarity:103/176 - (58%) Gaps:18/176 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQERYRA 75
            |.||:::|||||||::|::::...:|:::.|:|||.:|.|:.:::..|.:..||||||||||:::
plant     8 LLKVIVLGDSGVGKTSLMNQYVHKKFSMQYKATIGADFVTKELQIGEKLVTLQIWDTAGQERFQS 72

  Fly    76 ITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHA---------------DQNIVIMLVGNK 125
            :.:|:||||....||||:....:::|:|.|..|....|               .:....:::|||
plant    73 LGAAFYRGADCCALVYDVNVLRSFDNLETWHEEFLKQAWNIGMWTIAEASPSDPKTFPFIVLGNK 137

  Fly   126 SDL--RHLRSVPTDEAKLFAERNG-LSFIETSALDSTNVETAFQNI 168
            .|:  ...|.|...:|..:...|| :.:.||||.|..||:.||..|
plant   138 IDVDGGSSRVVSDKKAADWCASNGNIPYFETSAKDDFNVDEAFLTI 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 62/176 (35%)
RABG3ANP_001154217.1 Rab7 9..193 CDD:206655 61/175 (35%)

Return to query results.
Submit another query.