DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab11 and RAB7B

DIOPT Version :10

Sequence 1:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_188512.1 Gene:RAB7B / 821415 AraportID:AT3G18820 Length:206 Species:Arabidopsis thaliana


Alignment Length:186 Identity:68/186 - (36%)
Similarity:113/186 - (60%) Gaps:7/186 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQERYRA 75
            |.||:::|||||||::|::::...:|:.:.|:|||.:|.|:.::.:.:....||||||||||:::
plant     8 LLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQIWDTAGQERFQS 72

  Fly    76 ITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHAD----QNIVIMLVGNKSDL--RHLRSV 134
            :..|:||||...:||||:....::||:..|..|....|.    :|...:|:|||.|:  .:.|.|
plant    73 LGVAFYRGADCCVLVYDVNSMKSFENLNNWREEFLIQASPSDPENFPFVLIGNKVDVDDGNSRVV 137

  Fly   135 PTDEAKLF-AERNGLSFIETSALDSTNVETAFQNILTEIYRIVSQKQIRDPPEGDV 189
            ...:||.: |.:..:.:.||||...||||.|||.|..:..:...::::..|...||
plant   138 SEKKAKAWCASKGNIPYFETSAKVGTNVEEAFQCIAKDALKSGEEEELYLPDTIDV 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 65/168 (39%)
RAB7BNP_188512.1 Rab7 9..182 CDD:206655 64/172 (37%)

Return to query results.
Submit another query.