DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab11 and RABA1g

DIOPT Version :9

Sequence 1:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_188124.1 Gene:RABA1g / 820735 AraportID:AT3G15060 Length:217 Species:Arabidopsis thaliana


Alignment Length:216 Identity:143/216 - (66%)
Similarity:174/216 - (80%) Gaps:14/216 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAG 69
            :|:||:|:||||||||||||||||||||||||:||||||||||||||||.||.|.:|||||||||
plant     7 DDDYDFLYKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSIHVDEKIVKAQIWDTAG 71

  Fly    70 QERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRHLRSV 134
            |||||||||||||||||||||||:.:|:|:|||||||:|||||.:.||||||||||:||||||:|
plant    72 QERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTEANIVIMLVGNKADLRHLRAV 136

  Fly   135 PTDEAKLFAERNGLSFIETSALDSTNVETAFQNILTEIYRIVSQK--QIRDP----PEGDVIRPS 193
            .|::||.||||....|:|||||::.|||.||..:|::|||:.|:|  .|.|.    |:|..|...
plant   137 STEDAKAFAERENTFFMETSALEALNVENAFTEVLSQIYRVASKKALDIGDDHTTLPKGQSINVG 201

  Fly   194 NVEPIDVKPTVTADVRK-QCC 213
            :.:.:       ::|:| .||
plant   202 SKDDV-------SEVKKVGCC 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 127/163 (78%)
RABA1gNP_188124.1 Rab11_like 11..175 CDD:206660 127/163 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 267 1.000 Domainoid score I449
eggNOG 1 0.900 - - E2759_KOG0087
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37903
Inparanoid 1 1.050 296 1.000 Inparanoid score I808
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133775at2759
OrthoFinder 1 1.000 - - FOG0000259
OrthoInspector 1 1.000 - - otm2982
orthoMCL 1 0.900 - - OOG6_100582
Panther 1 1.100 - - O PTHR47979
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X277
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.