DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab11 and RABA4D

DIOPT Version :9

Sequence 1:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_187823.1 Gene:RABA4D / 820393 AraportID:AT3G12160 Length:222 Species:Arabidopsis thaliana


Alignment Length:223 Identity:127/223 - (56%)
Similarity:166/223 - (74%) Gaps:20/223 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GAREDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWD 66
            |....:.||:|||||||||.|||:.||:||.||||:::||:||||||.|:::.:|.||:||||||
plant     6 GDYNQKIDYVFKVVLIGDSAVGKTQLLARFARNEFSVDSKATIGVEFQTKTLVIDNKTVKAQIWD 70

  Fly    67 TAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRHL 131
            |||||||||:|||||||||||:||||:.|..:::::.:||.|||.|||:||||||:|||.||..|
plant    71 TAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMAKWLEELRGHADKNIVIMLIGNKCDLGSL 135

  Fly   132 RSVPTDEAKLFAERNGLSFIETSALDSTNVETAFQNILTEIYRIVSQKQIR---DPPEGD----- 188
            |:|||::|:.||:|..|.|:|||||::|||||||..||||||||:|:|.:.   |..:|:     
plant   136 RAVPTEDAQEFAQRENLFFMETSALEATNVETAFLTILTEIYRIISKKSLTADDDDADGNSSLLK 200

  Fly   189 ---VIRPSNVEPIDVKPTVTADVRKQCC 213
               :|.||..|         :..|..||
plant   201 GTRIIIPSEQE---------SGKRGGCC 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 111/163 (68%)
RABA4DNP_187823.1 Rab11_like 13..177 CDD:206660 111/163 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133775at2759
OrthoFinder 1 1.000 - - FOG0000259
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X277
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.780

Return to query results.
Submit another query.