DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab11 and RABA5d

DIOPT Version :9

Sequence 1:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_180726.1 Gene:RABA5d / 817724 AraportID:AT2G31680 Length:219 Species:Arabidopsis thaliana


Alignment Length:213 Identity:118/213 - (55%)
Similarity:158/213 - (74%) Gaps:4/213 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EDE--YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDT 67
            :||  .:||||:|:||||.|||||||||:.|||||..||:||||||.|:::|::||.:|||||||
plant     4 DDEGGEEYLFKIVIIGDSAVGKSNLLSRYARNEFNAHSKATIGVEFQTQNMEIEGKEVKAQIWDT 68

  Fly    68 AGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRHLR 132
            |||||:||:||||||||||||:||||::..|:|:|.|||.||:.|:|..:..||||||.||..:|
plant    69 AGQERFRAVTSAYYRGAVGALVVYDISRRSTFESVGRWLDELKTHSDTTVARMLVGNKCDLESIR 133

  Fly   133 SVPTDEAKLFAERNGLSFIETSALDSTNVETAFQNILTEIYRIVSQKQIR-DPPEGDVIRPSNVE 196
            :|..:|.|..||..||.|:||||||||||:|||:.::.:||..:|:||:. |..:.::...:.|.
plant   134 AVSVEEGKALAETEGLFFMETSALDSTNVKTAFEMVIRDIYTNISRKQLNSDTYKTELSMKNRVS 198

  Fly   197 PI-DVKPTVTADVRKQCC 213
            .: |...:.|......||
plant   199 LVKDDNKSSTQGFGFSCC 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 105/163 (64%)
RABA5dNP_180726.1 Rab11_like 10..174 CDD:206660 105/163 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133775at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.