DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab11 and rabl2b

DIOPT Version :9

Sequence 1:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001072451.1 Gene:rabl2b / 779905 XenbaseID:XB-GENE-979695 Length:225 Species:Xenopus tropicalis


Alignment Length:216 Identity:66/216 - (30%)
Similarity:110/216 - (50%) Gaps:24/216 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EDEYDYL--FKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDT 67
            :|:||..  .|::.:|||.||||.|:.||..:.|..:..||..:.....|..|||.|:....|||
 Frog    13 QDKYDSAENVKIICLGDSAVGKSKLMERFLMDGFRPQQLSTFALTLYKYSTCVDGNTVLVDFWDT 77

  Fly    68 AGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNK--SDLRH 130
            |||||:.::.::||..|...::|:|:.:.:||:|:.:|.:|||::..: |..::|.||  :|:| 
 Frog    78 AGQERFHSMHASYYHKAHACIMVFDVQRKITYKNLGKWYQELREYRPE-IPCIVVANKIDADIR- 140

  Fly   131 LRSVPTDEAKLFAERNGLSFIETSALDSTNVETAF--------------QNILTEIYRIVSQKQI 181
                .|.:...|.:::.|.|...||.|.|||...|              |:.|.|:.|.:...::
 Frog   141 ----VTQKGFNFGKKHNLPFYFVSAADGTNVVKLFKDAIKLAVSYKQNSQDFLDEVMRELENFEL 201

  Fly   182 RDPPEGDVIRPSNVEPIDVKP 202
            ......|:....::.....||
 Frog   202 EKQEAEDLSEKEDLSEDGEKP 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 60/181 (33%)
rabl2bNP_001072451.1 RabL2 22..182 CDD:133324 56/165 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.