DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab11 and Rab2b

DIOPT Version :9

Sequence 1:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_766189.1 Gene:Rab2b / 76338 MGIID:1923588 Length:216 Species:Mus musculus


Alignment Length:215 Identity:103/215 - (47%)
Similarity:133/215 - (61%) Gaps:10/215 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQER 72
            |.||||.::|||:|||||.||.:||...|......||||||..|.:.:|||.||.|||||||||.
Mouse     3 YAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVNIDGKQIKLQIWDTAGQES 67

  Fly    73 YRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRHLRSVPTD 137
            :|:||.:|||||.||||||||.:..|:.::..||.:.|.|:..|:||||:||||||...|.|..:
Mouse    68 FRSITRSYYRGAAGALLVYDITRRETFNHLTSWLEDARQHSSSNMVIMLIGNKSDLESRRDVKRE 132

  Fly   138 EAKLFAERNGLSFIETSALDSTNVETAFQNILTEIYRIVSQK--QIRDPPEGDVIRP-----SNV 195
            |.:.||..:||.|:||||..:.|||.|:.|...||||.:.|.  .:.:...|..|.|     |:|
Mouse   133 EGEAFAREHGLIFMETSAKTACNVEEAYINTAKEIYRKIQQGLFDVHNEANGIKIGPQQSITSSV 197

  Fly   196 EPIDVKPTVTADVRKQ--CC 213
            .|...:..| :|:...  ||
Mouse   198 GPCSPQQNV-SDIGPDSGCC 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 88/163 (54%)
Rab2bNP_766189.1 PLN03108 1..216 CDD:178655 101/213 (47%)
Rab2 3..170 CDD:206658 91/166 (55%)
Effector region. /evidence=ECO:0000250 35..43 4/7 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 189..216 6/27 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.