DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab11 and rab25b

DIOPT Version :9

Sequence 1:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001025142.1 Gene:rab25b / 574424 ZFINID:ZDB-GENE-050706-113 Length:210 Species:Danio rerio


Alignment Length:214 Identity:135/214 - (63%)
Similarity:175/214 - (81%) Gaps:6/214 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGAREDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIW 65
            ||: ::.|:::|||||||:|||||||||||||:|||:.:|::||||||:||:::::|.|||||||
Zfish     1 MGS-DEAYNFVFKVVLIGESGVGKSNLLSRFTKNEFSHDSRTTIGVEFSTRTVQLNGLTIKAQIW 64

  Fly    66 DTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRH 130
            ||||.|||||||||||||||||||||||:||||||:.||||:||.||||.:||:|||||||||..
Zfish    65 DTAGLERYRAITSAYYRGAVGALLVYDISKHLTYESAERWLKELYDHADPHIVVMLVGNKSDLAA 129

  Fly   131 LRSVPTDEAKLFAERNGLSFIETSALDSTNVETAFQNILTEIYRIVSQKQIRDPPEGDVIRPSNV 195
            :|||||::||.|||:|||.|.|||||:|.|||.||..:||||::.|:.|::   ..|.:...:..
Zfish   130 VRSVPTEDAKDFAEKNGLLFKETSALESVNVEAAFNTVLTEIHKKVNSKEV---TRGSISAVTLS 191

  Fly   196 EPIDVKPTVTADVRKQCCQ 214
            :|  ..|..|.:.:|.||:
Zfish   192 QP--KTPAETQEEKKTCCK 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 122/163 (75%)
rab25bNP_001025142.1 PLN03110 4..209 CDD:178657 133/210 (63%)
Rab11_like 9..172 CDD:206660 122/162 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133775at2759
OrthoFinder 1 1.000 - - FOG0000259
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.