DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab11 and RAB25

DIOPT Version :9

Sequence 1:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_065120.2 Gene:RAB25 / 57111 HGNCID:18238 Length:213 Species:Homo sapiens


Alignment Length:176 Identity:120/176 - (68%)
Similarity:151/176 - (85%) Gaps:0/176 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAG 69
            |::|:::|||||||:|||||:|||||||||||:.:|::||||||:||::.:....:|||||||||
Human     6 EEDYNFVFKVVLIGESGVGKTNLLSRFTRNEFSHDSRTTIGVEFSTRTVMLGTAAVKAQIWDTAG 70

  Fly    70 QERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRHLRSV 134
            .||||||||||||||||||||:|:.||.||..|||||:||.|||:..||:|||||||||...|.|
Human    71 LERYRAITSAYYRGAVGALLVFDLTKHQTYAVVERWLKELYDHAEATIVVMLVGNKSDLSQAREV 135

  Fly   135 PTDEAKLFAERNGLSFIETSALDSTNVETAFQNILTEIYRIVSQKQ 180
            ||:||::|||.|||.|:|||||||||||.||:.:|.||:..||:::
Human   136 PTEEARMFAENNGLLFLETSALDSTNVELAFETVLKEIFAKVSKQR 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 115/163 (71%)
RAB25NP_065120.2 Rab11_like 11..174 CDD:206660 115/162 (71%)
Effector region. /evidence=ECO:0000250 41..49 5/7 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133775at2759
OrthoFinder 1 1.000 - - FOG0000259
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.