DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab11 and rab11a

DIOPT Version :9

Sequence 1:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001016481.1 Gene:rab11a / 549235 XenbaseID:XB-GENE-489346 Length:216 Species:Xenopus tropicalis


Alignment Length:214 Identity:181/214 - (84%)
Similarity:191/214 - (89%) Gaps:0/214 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGAREDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIW 65
            ||.|:||||||||||||||||||||||||||||||||||||||||||||||||:|||||||||||
 Frog     1 MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIW 65

  Fly    66 DTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRH 130
            |||||||||||||||||||||||||||||||||||||||||:|||||||..||||||||||||||
 Frog    66 DTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNKIVIMLVGNKSDLRH 130

  Fly   131 LRSVPTDEAKLFAERNGLSFIETSALDSTNVETAFQNILTEIYRIVSQKQIRDPPEGDVIRPSNV 195
            ||:||||||:.|||:|||||||||||||||||.|||.|||||||||||.|:.|..|.|:...:||
 Frog   131 LRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQTQMSDRRENDMSPSNNV 195

  Fly   196 EPIDVKPTVTADVRKQCCQ 214
            .||.|.||.....:.||||
 Frog   196 VPIHVPPTTENKPKMQCCQ 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 153/163 (94%)
rab11aNP_001016481.1 Rab11_like 9..173 CDD:206660 153/163 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 300 1.000 Domainoid score I1408
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H37903
Inparanoid 1 1.050 358 1.000 Inparanoid score I2169
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133775at2759
OrthoFinder 1 1.000 - - FOG0000259
OrthoInspector 1 1.000 - - otm48179
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5006
SonicParanoid 1 1.000 - - X277
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.