DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab11 and Rab11a

DIOPT Version :9

Sequence 1:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_059078.2 Gene:Rab11a / 53869 MGIID:1858202 Length:216 Species:Mus musculus


Alignment Length:214 Identity:183/214 - (85%)
Similarity:193/214 - (90%) Gaps:0/214 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGAREDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIW 65
            ||.|:||||||||||||||||||||||||||||||||||||||||||||||||:|||||||||||
Mouse     1 MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIW 65

  Fly    66 DTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRH 130
            |||||||||||||||||||||||||||||||||||||||||:|||||||.|||||||||||||||
Mouse    66 DTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRH 130

  Fly   131 LRSVPTDEAKLFAERNGLSFIETSALDSTNVETAFQNILTEIYRIVSQKQIRDPPEGDVIRPSNV 195
            ||:||||||:.|||:|||||||||||||||||.|||.|||||||||||||:.|..|.|:...:||
Mouse   131 LRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQMSDRRENDMSPSNNV 195

  Fly   196 EPIDVKPTVTADVRKQCCQ 214
            .||.|.||.....:.||||
Mouse   196 VPIHVPPTTENKPKVQCCQ 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 154/163 (94%)
Rab11aNP_059078.2 Rab11_like 9..173 CDD:206660 154/163 (94%)
Effector region. /evidence=ECO:0000255 40..48 7/7 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 183..211 10/27 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834820
Domainoid 1 1.000 302 1.000 Domainoid score I1398
eggNOG 1 0.900 - - E2759_KOG0087
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37903
Inparanoid 1 1.050 363 1.000 Inparanoid score I2165
Isobase 1 0.950 - 0 Normalized mean entropy S128
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133775at2759
OrthoFinder 1 1.000 - - FOG0000259
OrthoInspector 1 1.000 - - otm43053
orthoMCL 1 0.900 - - OOG6_100582
Panther 1 1.100 - - LDO PTHR47979
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5006
SonicParanoid 1 1.000 - - X277
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.