DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab11 and Rab25

DIOPT Version :9

Sequence 1:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_058595.2 Gene:Rab25 / 53868 MGIID:1858203 Length:213 Species:Mus musculus


Alignment Length:230 Identity:133/230 - (57%)
Similarity:161/230 - (70%) Gaps:37/230 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGAREDE-YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQI 64
            ||.|.|| |:::|||||||:|||||:|||||||||||:.:|::||||||:||::.:....:||||
Mouse     1 MGNRTDEDYNFVFKVVLIGESGVGKTNLLSRFTRNEFSHDSRTTIGVEFSTRTVMLGTAAVKAQI 65

  Fly    65 WDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLR 129
            |||||.||||||||||||||||||||:|:.||.||..|||||:||.|||:..||:|||||||||.
Mouse    66 WDTAGLERYRAITSAYYRGAVGALLVFDLTKHQTYAVVERWLKELYDHAEATIVVMLVGNKSDLS 130

  Fly   130 HLRSVPTDEAKLFAERNGLSFIETSALDSTNVETAFQNILTEIYRIVS-QKQI------------ 181
            ..|.|||:||.:|||.|||.|:|||||||||||.|||.:|.||:..|| |||.            
Mouse   131 QAREVPTEEACMFAENNGLLFLETSALDSTNVELAFQTVLKEIFAKVSKQKQNSTRTSAITLGNA 195

  Fly   182 ---RDPPEGDVIRPSNVEPIDVKPTVTADVRKQCC 213
               :||..|:                    ::.||
Mouse   196 QAGQDPGPGE--------------------KRACC 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 116/163 (71%)
Rab25NP_058595.2 PLN03110 1..212 CDD:178657 133/230 (58%)
Rab11_like 11..174 CDD:206660 116/162 (72%)
Effector region. /evidence=ECO:0000250 41..49 5/7 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000259
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.