DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab11 and rab25

DIOPT Version :9

Sequence 1:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001007903.1 Gene:rab25 / 493286 XenbaseID:XB-GENE-494256 Length:216 Species:Xenopus tropicalis


Alignment Length:221 Identity:133/221 - (60%)
Similarity:175/221 - (79%) Gaps:14/221 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGAREDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIW 65
            ||:.|:|::::|||||||:|||||:||||||||||||.:|::||||||:||::.:||..:|:|||
 Frog     1 MGSEEEEFNFVFKVVLIGESGVGKTNLLSRFTRNEFNHDSRTTIGVEFSTRTLTIDGHLVKSQIW 65

  Fly    66 DTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLR- 129
            ||||.|||||||||||||||||||||||.||.:||:|:|||:||.||||.:||:||||||.||: 
 Frog    66 DTAGLERYRAITSAYYRGAVGALLVYDITKHQSYESVDRWLKELYDHADASIVVMLVGNKCDLKD 130

  Fly   130 HLRSVPTDEAKLFAERNGLSFIETSALDSTNVETAFQNILTEIY-RIVSQKQIRDPPEGDVIRPS 193
            ..:.||::|||.:||||||.||||||||:||||.||::||.:|| |::..|       |:..:||
 Frog   131 EAQEVPSEEAKAYAERNGLLFIETSALDATNVELAFESILRDIYMRVLKSK-------GETQQPS 188

  Fly   194 NVE-PIDVKP----TVTADVRKQCCQ 214
            .:. ..:..|    |:..:.::.|||
 Frog   189 TINLSKEASPTQSITLVTEQKRSCCQ 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 117/164 (71%)
rab25NP_001007903.1 Rab11_like 10..174 CDD:206660 117/163 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133775at2759
OrthoFinder 1 1.000 - - FOG0000259
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.