DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab11 and rab11a

DIOPT Version :9

Sequence 1:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001007360.1 Gene:rab11a / 492487 ZFINID:ZDB-GENE-041114-53 Length:215 Species:Danio rerio


Alignment Length:214 Identity:180/214 - (84%)
Similarity:194/214 - (90%) Gaps:1/214 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGAREDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIW 65
            ||.|:||||||||||||||||||||||||||||||||||||||||||||||||:|||||:|||||
Zfish     1 MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTVKAQIW 65

  Fly    66 DTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRH 130
            |||||||||||||||||||||||||||||||||||||||||:|||||||.|||||||||||||||
Zfish    66 DTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRH 130

  Fly   131 LRSVPTDEAKLFAERNGLSFIETSALDSTNVETAFQNILTEIYRIVSQKQIRDPPEGDVIRPSNV 195
            ||:||||||:.|||:|||||:|||||||||||||||.|||||||||||||:.|..:.|:...:||
Zfish   131 LRAVPTDEARAFAEKNGLSFLETSALDSTNVETAFQTILTEIYRIVSQKQMSDRRDNDMSPSNNV 195

  Fly   196 EPIDVKPTVTADVRKQCCQ 214
            ..|.|:||.... :.||||
Zfish   196 VSIQVQPTENKP-KMQCCQ 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 153/163 (94%)
rab11aNP_001007360.1 Rab11_like 9..173 CDD:206660 153/163 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577895
Domainoid 1 1.000 303 1.000 Domainoid score I1359
eggNOG 1 0.900 - - E2759_KOG0087
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37903
Inparanoid 1 1.050 357 1.000 Inparanoid score I2191
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133775at2759
OrthoFinder 1 1.000 - - FOG0000259
OrthoInspector 1 1.000 - - otm24548
orthoMCL 1 0.900 - - OOG6_100582
Panther 1 1.100 - - LDO PTHR47979
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5006
SonicParanoid 1 1.000 - - X277
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.