DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab11 and Rab7

DIOPT Version :9

Sequence 1:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster


Alignment Length:193 Identity:67/193 - (34%)
Similarity:115/193 - (59%) Gaps:7/193 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQERYRA 75
            |.||:::|||.|||::|::::....|:.:.|:|||.:|.|:.:.|:.:.:..||||||||||:::
  Fly     8 LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQS 72

  Fly    76 ITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHAD----QNIVIMLVGNKSDLRHLRSVPT 136
            :..|:||||...:||||:....:::|::.|..|....|.    .:...:::|||.||.: |.|.|
  Fly    73 LGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDN-RQVST 136

  Fly   137 DEAKLFAE-RNGLSFIETSALDSTNVETAFQNILTEIYRIVSQKQ-IRDPPEGDVIRPSNVEP 197
            ..|:.:.: :|.:.:.||||.:..|||.|||.|......:.::.: |.|.|:...:...|..|
  Fly   137 RRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVINDFPDQITLGSQNNRP 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 62/166 (37%)
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 61/170 (36%)
RAB 9..174 CDD:197555 61/165 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454513
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.