DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab11 and rab11ba

DIOPT Version :9

Sequence 1:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_999935.1 Gene:rab11ba / 406798 ZFINID:ZDB-GENE-040426-2860 Length:218 Species:Danio rerio


Alignment Length:218 Identity:182/218 - (83%)
Similarity:192/218 - (88%) Gaps:6/218 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGAREDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIW 65
            ||.|:|||||||:||||||||||||||||||||||||||||||||||||||||:|||||||||||
Zfish     1 MGTRDDEYDYLFRVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIW 65

  Fly    66 DTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRH 130
            |||||||||||||||||||||||||||||||||||||||||:|||||||.|||||||||||||||
Zfish    66 DTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDLRH 130

  Fly   131 LRSVPTDEAKLFAERNGLSFIETSALDSTNVETAFQNILTEIYRIVSQKQIRDPPEGDVIRPSNV 195
            ||:||||||:.|||:|.|||||||||||||||.||:||||||||||||||:.|.|..|....:||
Zfish   131 LRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQMVDRPGHDESPGNNV 195

  Fly   196 EPIDVKPTVTADVRK----QCCQ 214
            ..|.|.|  |.|..|    ||||
Zfish   196 VDISVPP--TTDGLKGNKFQCCQ 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 152/163 (93%)
rab11baNP_999935.1 PLN03110 5..217 CDD:178657 179/214 (84%)
Rab11_like 9..173 CDD:206660 152/163 (93%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 303 1.000 Domainoid score I1359
eggNOG 1 0.900 - - E2759_KOG0087
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 357 1.000 Inparanoid score I2191
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133775at2759
OrthoFinder 1 1.000 - - FOG0000259
OrthoInspector 1 1.000 - - otm24548
orthoMCL 1 0.900 - - OOG6_100582
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X277
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.730

Return to query results.
Submit another query.