DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab11 and Rab26

DIOPT Version :9

Sequence 1:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001097658.1 Gene:Rab26 / 40359 FlyBaseID:FBgn0086913 Length:410 Species:Drosophila melanogaster


Alignment Length:216 Identity:82/216 - (37%)
Similarity:126/216 - (58%) Gaps:22/216 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLES--KSTIGVEFATRSIEVDGKTIKAQIWDT 67
            |||:|.:.||:::|||||||::||.||....: :.|  .||:|::|..:.:.|||..:|.|||||
  Fly   206 EDEFDIMGKVIMLGDSGVGKTSLLIRFRDGRY-VPSYFLSTVGIDFRNKVVVVDGTRVKLQIWDT 269

  Fly    68 AGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLR-HL 131
            |||||:|::|.||||.|...||:||:....||:|:..||.|:|::|.:::||:|:|||:|.. ..
  Fly   270 AGQERFRSVTHAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIREYAQEDVVIVLIGNKADCSGSE 334

  Fly   132 RSVPTDEAKLFAERNGLSFIETSALDSTNVETAFQNILTEIYRIVSQKQIRDPPEG-----DVIR 191
            |.|..::.:.....:.:.|:||||....|||.:|    |.:.|.:..:......:|     |.:|
  Fly   335 RQVKREDGERLGREHNVPFMETSAKTGLNVELSF----TAVARQLKSRGYEHGDDGKFNVHDFVR 395

  Fly   192 PSNVEPIDVKPTVTADVRKQC 212
            .:         |....|..||
  Fly   396 DN---------TKARSVCAQC 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 71/166 (43%)
Rab26NP_001097658.1 Rab26 214..407 CDD:206695 76/206 (37%)
RAB 214..378 CDD:197555 71/168 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454462
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.