Sequence 1: | NP_477170.1 | Gene: | Rab11 / 42501 | FlyBaseID: | FBgn0015790 | Length: | 214 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001119853.1 | Gene: | rab4a / 403031 | ZFINID: | ZDB-GENE-040525-1 | Length: | 213 | Species: | Danio rerio |
Alignment Length: | 198 | Identity: | 94/198 - (47%) |
---|---|---|---|
Similarity: | 119/198 - (60%) | Gaps: | 19/198 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 DEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQ 70
Fly 71 ERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRHLRSVP 135
Fly 136 TDEAKLFAERNGLSFIETSALDSTNVETAF----QNILTEI---------------YRIVSQKQI 181
Fly 182 RDP 184 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab11 | NP_477170.1 | Rab11_like | 9..173 | CDD:206660 | 89/182 (49%) |
rab4a | NP_001119853.1 | RAB | 9..172 | CDD:197555 | 86/162 (53%) |
Rab4 | 9..169 | CDD:206696 | 84/159 (53%) | ||
Effector region. /evidence=ECO:0000250 | 37..45 | 5/7 (71%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |