DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab11 and rab4a

DIOPT Version :9

Sequence 1:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001119853.1 Gene:rab4a / 403031 ZFINID:ZDB-GENE-040525-1 Length:213 Species:Danio rerio


Alignment Length:198 Identity:94/198 - (47%)
Similarity:119/198 - (60%) Gaps:19/198 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQ 70
            :.||:|||.::||::|.|||.||.:|....|..:|..||||||.::.|.|..|.:|.||||||||
Zfish     3 ETYDFLFKFLVIGNAGTGKSCLLHQFIEKRFKDDSNHTIGVEFGSKIISVVNKFVKLQIWDTAGQ 67

  Fly    71 ERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRHLRSVP 135
            ||:|::|.:|||||.||||||||....||..:..||.:.|..|.|||||:|.|||.||...|.|.
Zfish    68 ERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVT 132

  Fly   136 TDEAKLFAERNGLSFIETSALDSTNVETAF----QNILTEI---------------YRIVSQKQI 181
            ..||..||:.|.|.|:|||||...|||.||    :.||.:|               |...:.:|:
Zfish   133 FLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGDAALRQL 197

  Fly   182 RDP 184
            |.|
Zfish   198 RSP 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 89/182 (49%)
rab4aNP_001119853.1 RAB 9..172 CDD:197555 86/162 (53%)
Rab4 9..169 CDD:206696 84/159 (53%)
Effector region. /evidence=ECO:0000250 37..45 5/7 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.