DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab11 and rab11al

DIOPT Version :9

Sequence 1:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_956417.1 Gene:rab11al / 386994 ZFINID:ZDB-GENE-031118-188 Length:216 Species:Danio rerio


Alignment Length:214 Identity:171/214 - (79%)
Similarity:186/214 - (86%) Gaps:0/214 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGAREDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIW 65
            |..||||||||||||||||||||||||||||||||||||||||||||||||||.|:|||:|||||
Zfish     1 MTGREDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIHVEGKTVKAQIW 65

  Fly    66 DTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRH 130
            ||||||||||||||||||||||||||||||||||||.||||:||:||||.|||||||||||||||
Zfish    66 DTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENAERWLKELQDHADSNIVIMLVGNKSDLRH 130

  Fly   131 LRSVPTDEAKLFAERNGLSFIETSALDSTNVETAFQNILTEIYRIVSQKQIRDPPEGDVIRPSNV 195
            ||:||.||||.|||::||||:|||||||:|||.|||.|||||||||||:|:....:......|.|
Zfish   131 LRAVPMDEAKAFAEKHGLSFLETSALDSSNVELAFQTILTEIYRIVSQRQMSGRGDDSFSPSSKV 195

  Fly   196 EPIDVKPTVTADVRKQCCQ 214
            .||.|:||..:..:..|||
Zfish   196 VPITVQPTQNSGKQSACCQ 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 147/163 (90%)
rab11alNP_956417.1 PLN03110 1..215 CDD:178657 171/214 (80%)
Rab11_like 9..173 CDD:206660 147/163 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 357 1.000 Inparanoid score I2191
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133775at2759
OrthoFinder 1 1.000 - - FOG0000259
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100582
Panther 1 1.100 - - O PTHR47979
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X277
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.830

Return to query results.
Submit another query.