DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab11 and RabX6

DIOPT Version :10

Sequence 1:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster


Alignment Length:166 Identity:61/166 - (36%)
Similarity:97/166 - (58%) Gaps:7/166 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KVVLIGDSGVGKSNLLSRFTRNEF--NLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQERYRA 75
            ||:|.||.|||||:|..||..|.|  :.:.|||:|::...|...|:.|.||.|:|||.|.||..:
  Fly    10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGGMERVAS 74

  Fly    76 ITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRHLR-SVPTDEA 139
            :||:||:.|.||:||:.:....::.::.:.|.::..:| :|..|.:.||||||.... .|..:|.
  Fly    75 VTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTYA-ENAKIFICGNKSDLDGREPEVSDEEV 138

  Fly   140 KLFAER-NGL--SFIETSALDSTNVETAFQNILTEI 172
            :.|.|: :.|  :..:||......||..|::|..::
  Fly   139 EAFCEQCHSLISATYKTSCRSGAGVEEMFRDISRQL 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 61/166 (37%)
RabX6NP_001261219.1 Rab 10..172 CDD:206640 61/162 (38%)

Return to query results.
Submit another query.