DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab11 and Rabl2

DIOPT Version :9

Sequence 1:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster
Sequence 2:XP_006242287.1 Gene:Rabl2 / 362987 RGDID:1306749 Length:250 Species:Rattus norvegicus


Alignment Length:215 Identity:67/215 - (31%)
Similarity:110/215 - (51%) Gaps:32/215 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EDEYD--YLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDT 67
            :::||  ...|::.:|||.||||.|:.||..:.|..:..||..:.....:..||||||....|||
  Rat    40 QEKYDAHENVKIICLGDSAVGKSKLMERFLMDGFQPQQLSTYALTLYKHTATVDGKTILVDFWDT 104

  Fly    68 AGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNK--SDLRH 130
            |||||::::.::||..|...::|:|:.:.:||:|:..|..|||:...: |..:||.||  :|:: 
  Rat   105 AGQERFQSMHASYYHKAHACIMVFDVQRKITYKNLGTWYAELREFRPE-IPCILVANKIDADIQ- 167

  Fly   131 LRSVPTDEAKLFAERNGLSFIETSALDSTNVETAFQN------------------ILTEIYRIVS 177
                .|.:...||::..|.....||.|.|||...|.:                  :|.|:.....
  Rat   168 ----MTQKNFSFAKKFSLPLYFVSAADGTNVVKLFNDAIRLAVAYKKSSQDFMDEVLQELENFKL 228

  Fly   178 QKQIRDPP---EGDVIR-PS 193
            :::..|.|   :||:.: ||
  Rat   229 EQKEEDTPDQEQGDMSKSPS 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 60/185 (32%)
Rabl2XP_006242287.1 RabL2 49..209 CDD:133324 57/165 (35%)
RAB 49..198 CDD:197555 56/154 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.