DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab11 and Rab32

DIOPT Version :9

Sequence 1:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_525109.1 Gene:Rab32 / 35940 FlyBaseID:FBgn0002567 Length:686 Species:Drosophila melanogaster


Alignment Length:221 Identity:66/221 - (29%)
Similarity:124/221 - (56%) Gaps:18/221 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGAREDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTI-KAQI 64
            |.:..|:.::|:|:::||:.|.||::.:.|:....|:...::||||:||.:.::.|..|| :.|:
  Fly   473 MTSTSDKREHLYKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQL 537

  Fly    65 WDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHAD----QNIVIMLVGNK 125
            ||.|||||:..:|..||:.||||.:|:|:.:..|::.|.:|..:|.....    ..|..:|:.||
  Fly   538 WDIAGQERFGNMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANK 602

  Fly   126 SDLRHLRSVPTDEAKL--FAERNGLS-FIETSALDSTNVETAFQNILTEIYRIVSQKQI-RDPPE 186
            .| :..:.:.|...|:  :...||.: :.||||.::.|::.|.:.::.:|  :::.|.| .|..:
  Fly   603 CD-QEKQGIITQPEKMDEYVRENGFAGWFETSAKENINIDEAARALVNKI--LINDKLISADLAD 664

  Fly   187 GDVIRPSNVEPIDVKPTVTADVRKQC 212
            ||..   |:...|   ...:|.:.:|
  Fly   665 GDKF---NLSAAD---ATGSDAKNKC 684

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 54/171 (32%)
Rab32NP_525109.1 Rab32_Rab38 484..686 CDD:206692 63/210 (30%)
RAB 484..652 CDD:197555 54/170 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454519
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.