DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab11 and Rab14

DIOPT Version :9

Sequence 1:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster


Alignment Length:214 Identity:101/214 - (47%)
Similarity:131/214 - (61%) Gaps:3/214 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGAREDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIW 65
            |.|....|:|:||.::|||.|||||.||.:||..:|......||||||.||.||||.|.||.|||
  Fly    25 MTAAPYNYNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIW 89

  Fly    66 DTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRH 130
            |||||||:||:|.:|||||.|||:||||.:..||.::..||.:.|:..:.:.||.|:||||||..
  Fly    90 DTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLES 154

  Fly   131 LRSVPTDEAKLFAERNGLSFIETSALDSTNVETAFQNILTEIYRIVSQKQ--IRDPPEGDVIRPS 193
            .|.|..:|||.||:.|||.|:|.||:...|||.||.....:||:.:.:.:  :.....|...|||
  Fly   155 TREVTYEEAKEFADENGLMFLEASAMTGQNVEEAFLETARKIYQNIQEGRLDLNASESGVQHRPS 219

  Fly   194 NVEPIDVKPTVTADVRKQC 212
            ......:....|. .:.||
  Fly   220 QPSRTSLSSEATG-AKDQC 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 89/163 (55%)
Rab14NP_788056.1 Rab14 34..199 CDD:133322 91/164 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454431
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.