DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab11 and Rab39

DIOPT Version :10

Sequence 1:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_780771.1 Gene:Rab39 / 270160 MGIID:2442855 Length:217 Species:Mus musculus


Alignment Length:74 Identity:18/74 - (24%)
Similarity:31/74 - (41%) Gaps:10/74 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RAGLQFPVGRIHRHLK-----NRTTSHGRVGATAAV---YSAAILEYLTAEVLELAGNASK-DLK 78
            |.|...| |::.:..:     |.:.|.|:.....|:   .:|:|.:....:|:....|..| ||:
Mouse    65 RTGKMMP-GKMQKSKQRLRNDNLSQSKGKPDLNTALPIRQTASIFKQPVTKVVNHPNNKVKSDLQ 128

  Fly    79 VKRITPRHL 87
            .....||.|
Mouse   129 RATEQPRQL 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 18/74 (24%)
Rab39NP_780771.1 Rab39 7..217 CDD:133311 18/74 (24%)
Switch-I. /evidence=ECO:0000255|PROSITE-ProRule:PRU00753 39..47
Switch-II. /evidence=ECO:0000255|PROSITE-ProRule:PRU00753 71..87 3/16 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.