DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab11 and RAB26

DIOPT Version :10

Sequence 1:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_055168.2 Gene:RAB26 / 25837 HGNCID:14259 Length:256 Species:Homo sapiens


Alignment Length:187 Identity:79/187 - (42%)
Similarity:120/187 - (64%) Gaps:5/187 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGAREDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLES-KSTIGVEFATRSIEVDGKTIKAQI 64
            :|...|.||..|||:|:|||||||:.||.||....|...: .||:|::|..:.::|||..:|.|:
Human    53 LGGGVDFYDVAFKVMLVGDSGVGKTCLLVRFKDGAFLAGTFISTVGIDFRNKVLDVDGVKVKLQM 117

  Fly    65 WDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLR 129
            ||||||||:|::|.||||.|...||:||:....:::|::.||.|:.::|..::.:||:|||.|..
Human   118 WDTAGQERFRSVTHAYYRDAHALLLLYDVTNKASFDNIQAWLTEIHEYAQHDVALMLLGNKVDSA 182

  Fly   130 HLRSVPTDEAKLFAERNGLSFIETSALDSTNVETAFQNILTEIYRIVSQKQIRDPPE 186
            |.|.|..::.:..|:..||.|:||||....||:.||    |.|.:.:.|:.::.|.|
Human   183 HERVVKREDGEKLAKEYGLPFMETSAKTGLNVDLAF----TAIAKELKQRSMKAPSE 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 72/164 (44%)
RAB26NP_055168.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51
Rab26 64..254 CDD:206695 75/176 (43%)
Switch 1. /evidence=ECO:0000250|UniProtKB:P62820 86..101 4/14 (29%)
Switch 2. /evidence=ECO:0000250|UniProtKB:P62820 119..136 12/16 (75%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.