DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab11 and ypt3

DIOPT Version :9

Sequence 1:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001342809.1 Gene:ypt3 / 2542219 PomBaseID:SPAC18G6.03 Length:214 Species:Schizosaccharomyces pombe


Alignment Length:215 Identity:146/215 - (67%)
Similarity:176/215 - (81%) Gaps:8/215 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 REDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTA 68
            :|||||||||.||||||||||||||.||||||||:|||||||||||||:|.:|.|.|||||||||
pombe     3 QEDEYDYLFKTVLIGDSGVGKSNLLMRFTRNEFNIESKSTIGVEFATRNIVLDNKKIKAQIWDTA 67

  Fly    69 GQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRHLRS 133
            ||||||||||||||||||||:||||.|..:::||.|||:|||:|||.||||||||||:||.|||:
pombe    68 GQERYRAITSAYYRGAVGALIVYDITKQSSFDNVGRWLKELREHADSNIVIMLVGNKTDLLHLRA 132

  Fly   134 VPTDEAKLFAERNGLSFIETSALDSTNVETAFQNILTEIYRIVSQKQIRDPPEGDVIRPSNVEPI 198
            |.|:||:.||..|.||||||||:|::|||.|||.:||||:||||.:.:....:|  :.|:..:.:
pombe   133 VSTEEAQAFAAENNLSFIETSAMDASNVEEAFQTVLTEIFRIVSNRSLEAGDDG--VHPTAGQTL 195

  Fly   199 DVKPTVTADVRK-----QCC 213
            ::.||:. |:.|     |||
pombe   196 NIAPTMN-DLNKKKSSSQCC 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 128/163 (79%)
ypt3NP_001342809.1 Rab11_like 8..172 CDD:206660 128/163 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 252 1.000 Domainoid score I396
eggNOG 1 0.900 - - E2759_KOG0087
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37903
Inparanoid 1 1.050 288 1.000 Inparanoid score I646
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000259
OrthoInspector 1 1.000 - - oto100980
orthoMCL 1 0.900 - - OOG6_100582
Panther 1 1.100 - - O PTHR47979
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5006
SonicParanoid 1 1.000 - - X277
TreeFam 1 0.960 - -
1312.850

Return to query results.
Submit another query.