DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab11 and ypt4

DIOPT Version :9

Sequence 1:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_594796.1 Gene:ypt4 / 2542113 PomBaseID:SPAC1B3.11c Length:234 Species:Schizosaccharomyces pombe


Alignment Length:240 Identity:90/240 - (37%)
Similarity:135/240 - (56%) Gaps:39/240 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEV----DGKTIKAQIW 65
            ::.||||.|:||.|.||.|||.||.||.:|:::.:...|:|::||:|.|.|    ..|.||.|||
pombe     3 KESYDYLVKIVLAGPSGTGKSCLLQRFVKNQWDDQVSHTVGIDFASRIISVGMGNQQKRIKLQIW 67

  Fly    66 DTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRH 130
            ||||||::|::...|||||.||:||||:....::|.:..||.::|..|...|.::|.|:||||::
pombe    68 DTAGQEKFRSVARNYYRGAAGAVLVYDVTNKDSFEELSSWLSDIRAMAPSTICVVLAGSKSDLQN 132

  Fly   131 LRSVPTDEAKLF-AERNGLSFIETSALDSTNVETAFQNILTEIYRIVSQKQIRDPPE-------G 187
            .|.|.|:||..| :|::..|..|||:...:|||..|.::::.|...:...:| ||.:       |
pombe   133 QRQVSTEEAAEFCSEKHISSAHETSSYTGSNVEECFLSVVSTIITRIELGEI-DPQDQSLGIQYG 196

  Fly   188 DVI--RPSNVEPIDVKPTVTAD-----------------VRKQCC 213
            |:.  ||       |.|:.|::                 .|..||
pombe   197 DLSFRRP-------VHPSSTSNWWTSITNWDDLVRLERQTRSYCC 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 75/168 (45%)
ypt4NP_594796.1 RAB 10..178 CDD:197555 73/167 (44%)
Rab 10..173 CDD:206640 72/162 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.