DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab11 and Rab18

DIOPT Version :10

Sequence 1:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001265376.1 Gene:Rab18 / 19330 MGIID:102790 Length:212 Species:Mus musculus


Alignment Length:167 Identity:76/167 - (45%)
Similarity:108/167 - (64%) Gaps:8/167 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KVVLIGDSGVGKSNLLSRFTRNEFNLESKSTI------GVEFATRSIEVDGKTIKAQIWDTAGQE 71
            |:::||:||||||:||.|||.:.|:.|..:||      ||:|..::|.|||...|..||||||||
Mouse    10 KILIIGESGVGKSSLLLRFTDDTFDPELAATIEFSFLQGVDFKVKTISVDGNKAKLAIWDTAGQE 74

  Fly    72 RYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQN-IVIMLVGNKSDLRHLRSVP 135
            |:|.:|.:|||||.|.:||||:.:..|:..::.||.||..:..:| ||.||||||.| :..|.|.
Mouse    75 RFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKID-KENREVD 138

  Fly   136 TDEAKLFAERNGLSFIETSALDSTNVETAFQNILTEI 172
            .:|...||.::.:.|||.||.....|:.||:.::.:|
Mouse   139 RNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKI 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 76/167 (46%)
Rab18NP_001265376.1 Rab18 9..175 CDD:206656 75/165 (45%)

Return to query results.
Submit another query.