DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab11 and Rab11b

DIOPT Version :9

Sequence 1:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster
Sequence 2:XP_030105459.1 Gene:Rab11b / 19326 MGIID:99425 Length:278 Species:Mus musculus


Alignment Length:276 Identity:181/276 - (65%)
Similarity:190/276 - (68%) Gaps:62/276 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGAREDEYDYLFK---------------------------------------------------- 13
            ||.|:||||||||                                                    
Mouse     1 MGTRDDEYDYLFKGAPCGVQTGEVAVATGGPKPCYRNRELRVEARTSTGPIRAGSRRKPGQVEFA 65

  Fly    14 --------VVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQ 70
                    ||||||||||||||||||||||||||||||||||||||||:||||||||||||||||
Mouse    66 RLRALVRSVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQ 130

  Fly    71 ERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRHLRSVP 135
            ||||||||||||||||||||||||||||||||||||:|||||||.|||||||||||||||||:||
Mouse   131 ERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVP 195

  Fly   136 TDEAKLFAERNGLSFIETSALDSTNVETAFQNILTEIYRIVSQKQIRDPPEGDVIRPSNVEPIDV 200
            ||||:.|||:|.|||||||||||||||.||:|||||||||||||||.|....|....:||..|.|
Mouse   196 TDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQIADRAAHDESPGNNVVDISV 260

  Fly   201 KPTVTAD--VRKQCCQ 214
            .||....  .:.||||
Mouse   261 PPTTDGQRPNKLQCCQ 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 153/223 (69%)
Rab11bXP_030105459.1 Rab11_like 74..233 CDD:206660 148/158 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 302 1.000 Domainoid score I1398
eggNOG 1 0.900 - - E2759_KOG0087
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 363 1.000 Inparanoid score I2165
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133775at2759
OrthoFinder 1 1.000 - - FOG0000259
OrthoInspector 1 1.000 - - otm43053
orthoMCL 1 0.900 - - OOG6_100582
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5006
SonicParanoid 1 1.000 - - X277
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.760

Return to query results.
Submit another query.