DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab11 and rab-11.1

DIOPT Version :9

Sequence 1:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_490675.1 Gene:rab-11.1 / 171601 WormBaseID:WBGene00004274 Length:211 Species:Caenorhabditis elegans


Alignment Length:218 Identity:173/218 - (79%)
Similarity:186/218 - (85%) Gaps:14/218 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGAREDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIW 65
            ||:|:||||||||||||||||||||||||||||||||||||||||||||||||.|:|||:|||||
 Worm     1 MGSRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSISVEGKTVKAQIW 65

  Fly    66 DTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRH 130
            |||||||||||||||||||||||||||||||:|||||||||:|||||||||||||||||||||||
 Worm    66 DTAGQERYRAITSAYYRGAVGALLVYDIAKHVTYENVERWLKELRDHADQNIVIMLVGNKSDLRH 130

  Fly   131 LRSVPTDEAKLFAERNGLSFIETSALDSTNVETAFQNILTEIYRIVSQKQIRDPPEG-----DVI 190
            ||:|||||||::||||.|||||||||||||||.||.|||||||:.||.|.:....:|     ..|
 Worm   131 LRAVPTDEAKIYAERNQLSFIETSALDSTNVEAAFTNILTEIYKSVSNKHVGTDRQGYGGGSGTI 195

  Fly   191 RPSNVEPIDVKPTVTADVRKQCC 213
            .||   |....|      :||||
 Worm   196 IPS---PASDPP------KKQCC 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 152/163 (93%)
rab-11.1NP_490675.1 PLN03110 5..209 CDD:178657 168/212 (79%)
Rab11_like 9..173 CDD:206660 152/163 (93%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 300 1.000 Domainoid score I768
eggNOG 1 0.900 - - E2759_KOG0087
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37903
Inparanoid 1 1.050 331 1.000 Inparanoid score I1433
Isobase 1 0.950 - 0 Normalized mean entropy S128
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133775at2759
OrthoFinder 1 1.000 - - FOG0000259
OrthoInspector 1 1.000 - - oto18727
orthoMCL 1 0.900 - - OOG6_100582
Panther 1 1.100 - - LDO PTHR47979
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5006
SonicParanoid 1 1.000 - - X277
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.850

Return to query results.
Submit another query.