DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5745 and CG5916

DIOPT Version :9

Sequence 1:NP_650941.3 Gene:CG5745 / 42498 FlyBaseID:FBgn0038855 Length:546 Species:Drosophila melanogaster
Sequence 2:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster


Alignment Length:298 Identity:72/298 - (24%)
Similarity:116/298 - (38%) Gaps:63/298 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 KFQVVL----DSPQLDLVALKKISWSGVPRKMRAVSWRLLSKYLPPSSERRMAVLESKRQGYQDL 284
            |::.:|    |..|:| ..||:....|:|...|...|..:|.  ..:::||.          .||
  Fly    45 KWEAILQQNTDLTQVD-AKLKRYIRKGIPGPYRPDVWMKISG--AAAAQRRS----------PDL 96

  Fly   285 RHNYFRVDSQDETQQDTYRQIHIDVPRMNPQIPLFQQQLVQEMFERILFIWAIRHPASGYVQGIN 349
            ..|..|.:..|:...|:   |.||:||..|....|..:  ::....||..:|..:...||.||:|
  Fly    97 FRNLLRTEPFDKEISDS---ISIDLPRTFPDNIHFDMK--KQRLYNILIAYAHHNRDVGYCQGLN 156

  Fly   350 DLVTPFFIVFLQEALTPNTDLEKYDMSTLPEETRNIIEADSFWCLSKFLDCIQDNYIFAQLGIQE 414
            .:.....||         ||.|:                .|||.|...::.|...|     ....
  Fly   157 YIAGLLLIV---------TDDEE----------------KSFWLLKHIVENIVPQY-----HSHN 191

  Fly   415 KVNQLKDL-------IQRIDVNLHRHLQAHGVDYLQFSFRWMNNLLTRELPLHCTIRLWDTYLAE 472
            ..|.|:||       |:||.. ::||:...|:.|...:.:|...:....||:...:|:||...||
  Fly   192 MANLLRDLAVFRELVIRRIPA-VNRHVDNLGLPYPVIASKWFICIFAEVLPVETVLRIWDCVFAE 255

  Fly   473 SDGFALFHLYVCAAFLLHWKEQLMQQNDFQGLMLLLQN 510
              |:.:........|:.| |..::..:|...|..|.::
  Fly   256 --GYKIVFRAALTMFVTH-KNAILGCDDIAALANLFRD 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5745NP_650941.3 TBC 243..496 CDD:214540 62/259 (24%)
CG5916NP_001287357.1 TBC 67..276 CDD:214540 62/259 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456637
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.