DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5745 and wkd

DIOPT Version :9

Sequence 1:NP_650941.3 Gene:CG5745 / 42498 FlyBaseID:FBgn0038855 Length:546 Species:Drosophila melanogaster
Sequence 2:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster


Alignment Length:299 Identity:72/299 - (24%)
Similarity:121/299 - (40%) Gaps:65/299 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 SLPDSNENRSRLRNYPGRPQLQKISSNCQDSEYETKIEKFQVVLDSPQLDLVA-LKKI---SWSG 246
            |.||.|      ..|.|..:..|.......::...:.:|:..::|:..:.:.. .|||   ...|
  Fly    19 SCPDRN------GFYGGFQRTDKPKEPLSKAQIIAREKKWLYMIDNWSIYMSKNYKKIRDRCRKG 77

  Fly   247 VPRKMRAVSWRLLS-KYLPPSSERRMAVLESKRQG-YQDLRHNYFRVDSQDETQQDTYRQ----- 304
            :|:.:|..:|..|| .||          |:.|... |.:|........:.:|.::|.:||     
  Fly    78 IPKSVRPKAWFYLSGAYL----------LKKKNPNVYNELLEKPGNPTTIEEIKKDKHRQFPFHE 132

  Fly   305 IHIDVPRMNPQIPLFQQQLVQEMFERILFIWAIRHPASGYVQGINDLVTPFFIVFLQEALTPNTD 369
            :.:|..::. ||.||          .:|..::|.:|..|:.|                |..|   
  Fly   133 MFLDEQKVG-QIELF----------NVLKAYSIYNPKVGFCQ----------------AQAP--- 167

  Fly   370 LEKYDMSTLPEETRNIIEADSFWCLSKFLDC-IQDNYIFAQLGIQEKVNQLKDLIQRIDVNLHRH 433
            :..:.:..||.|       |:||......|. :||.:|.....||.....|:.|:::....::||
  Fly   168 IAAFLLMHLPAE-------DAFWVFVSVCDVYLQDYFIPGLEVIQNDAGILEGLLKKTCPPVYRH 225

  Fly   434 LQAHGVDYLQFSFRWMNNLLTRELPLHCTIRLWDTYLAE 472
            ||.|.|:.|.:...|....:||.||....:|:||.:|||
  Fly   226 LQKHKVEPLLYMTDWFLCAMTRTLPWETLLRVWDCFLAE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5745NP_650941.3 TBC 243..496 CDD:214540 60/238 (25%)
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 48/188 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456632
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.