DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5745 and CG42795

DIOPT Version :9

Sequence 1:NP_650941.3 Gene:CG5745 / 42498 FlyBaseID:FBgn0038855 Length:546 Species:Drosophila melanogaster
Sequence 2:NP_001287272.1 Gene:CG42795 / 41252 FlyBaseID:FBgn0261928 Length:3213 Species:Drosophila melanogaster


Alignment Length:365 Identity:74/365 - (20%)
Similarity:119/365 - (32%) Gaps:85/365 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 VSSSSTDDCKEDRRSLPDSNENRSRLRNYPGR------------PQLQKISSNCQDSEYETKIEK 224
            :||::|..........|.|.:.....||..|.            |.....:.:...|:|...:..
  Fly   147 LSSNNTITTPGSNNRSPSSTKTTMLTRNGGGHGTSPTASGSGHAPSATAAADDEATSDYNQWLHA 211

  Fly   225 FQVVLDSPQLDLVALKKISWSGVPRKMRAVSW-RLLSKYLPPSSERRMAVLESKRQGYQDLRHNY 288
            .::|...|            .|.|.:.|...| .|..||           |:||...:...|...
  Fly   212 MKLVARLP------------GGTPPEFRRKLWLSLADKY-----------LKSKNVDWAQQREKC 253

  Fly   289 FRVDSQDETQQDTYRQIHIDVPRMNPQI---PLFQQQLVQEMFERILFIWAIRHPASGYVQGIND 350
            | .:...|..::...||..|:.|....:   |  ...:.|...:|||..:|..:|..||.||.|.
  Fly   254 F-CEEWREDDEELGIQIVKDLHRTGSNLCTGP--AGSINQAKLKRILLGYARYNPEVGYCQGFNM 315

  Fly   351 LVTPFFIVFLQEALTPNTDLEKYDMSTLPEETRNIIEADSFWCLSKFLDCIQDNYIFAQL-GIQE 414
            |......|..:|        |:..|..:......::..               .|.:..: |:|.
  Fly   316 LGALILQVMDKE--------EEESMKVMIYLVEGVLPT---------------GYFYGSMGGLQA 357

  Fly   415 KVNQLKDLIQRIDVNLHRHLQAHGVDYLQ--------------FSFRWMNNLLTRELPLHCTIRL 465
            .:...::|:|.....|.:|||.     ||              |:.:|...:....||:.|.:|:
  Fly   358 DMGVFRELMQTRLPRLAKHLQR-----LQGPVENAFEPPLTNVFTMQWFLTMFCTCLPMSCVLRV 417

  Fly   466 WDTYLAESDGFALFHLYVCAAFLLHWKEQLMQQNDFQGLM 505
            ||..|.|.....|....|..:.|......:...::|.|.|
  Fly   418 WDLVLIEGSDVLLRTALVLWSLLEERVISVRSADEFYGKM 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5745NP_650941.3 TBC 243..496 CDD:214540 58/271 (21%)
CG42795NP_001287272.1 RabGAP-TBC 268..443 CDD:278964 45/204 (22%)
DUF4682 560..684 CDD:292361
DBP 1112..1415 CDD:289157
SWIRM-assoc_2 <2376..2482 CDD:293105
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456603
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.