DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5745 and CG8155

DIOPT Version :9

Sequence 1:NP_650941.3 Gene:CG5745 / 42498 FlyBaseID:FBgn0038855 Length:546 Species:Drosophila melanogaster
Sequence 2:NP_611029.3 Gene:CG8155 / 36698 FlyBaseID:FBgn0034009 Length:1098 Species:Drosophila melanogaster


Alignment Length:324 Identity:70/324 - (21%)
Similarity:120/324 - (37%) Gaps:86/324 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 NENRSRLRNYPGRPQLQKISSNCQDSEYETKIEKFQVVLDSPQLDLVALKKISWSGVPRKMRAVS 255
            |.:...:.|.|.||.:      | |||:...::....:....:|..|    |...|:...:|.|.
  Fly   182 NLSEEHMANLPPRPPM------C-DSEFRLFLDALGQIQRKDELHRV----IFLGGIDPSLRRVV 235

  Fly   256 WR-LLSKY------LPPSSERRMAVLESKRQGYQDLRHNYFRVDSQDETQQDTYR---------- 303
            |: ||:.|      |.....:||..:..|.:.|..||              ||::          
  Fly   236 WKHLLNVYPGGANGLALDGHQRMEFMRRKSEQYCRLR--------------DTWKAAVKRGSVAG 286

  Fly   304 -------QIHIDVPRMNPQIPLF----QQQLVQEMFERILFIWAIRHPASGYVQGINDLVTPFFI 357
                   .:..||.|.:...|.:    ..|.:..:| .||..:|:.||:..|.||::|:.:|..:
  Fly   287 ELAYVTSMVKKDVLRTDRLHPFYAGSDDNQNIAALF-NILTTYALNHPSVSYCQGMSDIASPLLV 350

  Fly   358 VFLQEALTPNTDLEKYDMSTLPEETRNIIEADSFWCLSKFLDCIQDNYIFAQLGIQEKVNQLKDL 422
                   |.|.                  ||.::.|....:..::.|::...:.:.:|...|.:.
  Fly   351 -------TMND------------------EAQAYICFCAIMSRMRGNFMLDGIAMTQKFAHLTEA 390

  Fly   423 IQRIDVNLHRHLQAHGVDYLQFSFRWMNNLLTRELPLHCTIRL----WDTYLAESDG---FALF 479
            :...|.....:|::...|.|.|.:||:...|.||.|....:|:    |.:.....||   .|||
  Fly   391 LSFYDPEFWEYLKSQQADDLLFCYRWLLLELKREFPFEDALRMLEVQWSSLRYRCDGEKELALF 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5745NP_650941.3 TBC 243..496 CDD:214540 58/272 (21%)
CG8155NP_611029.3 TBC 225..439 CDD:214540 52/253 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456641
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.