DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5745 and RN-tre

DIOPT Version :9

Sequence 1:NP_650941.3 Gene:CG5745 / 42498 FlyBaseID:FBgn0038855 Length:546 Species:Drosophila melanogaster
Sequence 2:NP_652381.1 Gene:RN-tre / 36554 FlyBaseID:FBgn0020620 Length:571 Species:Drosophila melanogaster


Alignment Length:387 Identity:89/387 - (22%)
Similarity:146/387 - (37%) Gaps:85/387 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 DRRSLPDSNENRS-----RLRNY--------PGRPQLQKISSNCQDSEYETKIEKFQVVLDSPQL 234
            |..::.||.||.:     |...|        |.....|::..|..:.|.:.|..|.......|| 
  Fly    30 DPSNVVDSWENPTFEIYHRTDKYGFLHDSRLPSTRDAQEVHRNKIEMERDKKWMKMLNQWPPPQ- 93

  Fly   235 DLVALKKISWSGVPRKMRAVSWRLLSKYLPPSSERRMAVLESKRQGYQDLRHN---YFRVDSQDE 296
              ..|.|..:.|:|.::|.|:|..|              |:.:    |.:.:|   |.|:.....
  Fly    94 --DKLHKRVYKGIPDRVRMVAWNKL--------------LDIQ----QSINNNAGVYLRMLQLAR 138

  Fly   297 TQQDTYRQIHIDVPRMNPQIPLFQQQ--LVQEMFERILFIWAIRHPASGYVQGINDLVTPFFIVF 359
            ......|||..||.|.......|:::  :.|.....:|..::|.:...||.||: ..|....:::
  Fly   139 KYSTETRQIDADVNRQFRDNLAFRERYSVKQCSLFNVLNAYSIYNSELGYCQGM-ACVAGVLLLY 202

  Fly   360 LQE-----ALTPNTDLEKYDMSTLPEETRNIIEADSFWCLSKFLDCIQDNYIFAQLGIQEKVNQL 419
            |.|     ||......:||.|..|      .||  .|..|::|:|                  ..
  Fly   203 LHEEEAFWALNTLITDQKYGMHGL------FIE--GFPKLTRFID------------------HH 241

  Fly   420 KDLIQRIDVNLHRHLQAHGVDYLQFSFRWMNNLLTRELPLHCTIRLWDTYLAESD----GFALFH 480
            ..::.:|...||:|...|.||.|.::.:|...:....:|...::|:||.::.:.|    ..|:..
  Fly   242 DRIMSKIMRKLHKHFTKHNVDALLYAIKWFFVVFVERVPFSLSLRVWDIFMLDGDRVILSMAITI 306

  Fly   481 LYVCAAFLLHWKEQLMQQNDFQGLMLLLQNLPTHNW---SDRQINVLLAEAFRLKFTYADAP 539
            ||      || |::|::..|...::..||.....|:   .|..|..|.....:||....|.|
  Fly   307 LY------LH-KDELLRLKDMDAIIEYLQVRLHKNFGYSDDDAIQALERVMKKLKDLKLDVP 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5745NP_650941.3 TBC 243..496 CDD:214540 60/266 (23%)
RN-treNP_652381.1 TBC 100..315 CDD:214540 60/266 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456612
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.