DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5745 and Tbc1d15-17

DIOPT Version :9

Sequence 1:NP_650941.3 Gene:CG5745 / 42498 FlyBaseID:FBgn0038855 Length:546 Species:Drosophila melanogaster
Sequence 2:NP_001259806.1 Gene:Tbc1d15-17 / 33184 FlyBaseID:FBgn0031233 Length:715 Species:Drosophila melanogaster


Alignment Length:417 Identity:98/417 - (23%)
Similarity:166/417 - (39%) Gaps:108/417 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 AGDAAHFSRQVS----QTVALNVIETHSRSNQNHNASRSANESGADLVPVSSSSTDDCKEDR--R 185
            :||     ||.|    |.:.|:.....:.|:...:...||.:|.||    |...|.:.::::  .
  Fly   274 SGD-----RQTSPDNYQIIGLSGSTNSACSSNGQSRGGSAEKSPAD----SELETLNAQDEKIVN 329

  Fly   186 SLPDSNENRSRLRNYPGRPQLQKISSNCQDSEYETKIEKFQVVLDSPQLDLVALKKISW-SGVPR 249
            :|||    |.|:..  |.|..            ||:..:||.. |....|...:|::.: .||.:
  Fly   330 NLPD----RQRVER--GHPLT------------ETQWLEFQTP-DGRISDSARIKELIFRGGVVQ 375

  Fly   250 KMRAVSWR-LLSKYLPPSSERRMAVLESKRQ---GYQDLRHNYFRVDSQDETQQDTYR----QIH 306
            .:|...|: ||:.||  .|:..:..:|.::|   .|.:::..:..:.:..|.....||    ||.
  Fly   376 SLRPEVWKFLLNYYL--WSDTHVERIERRKQKSIEYYNMKAQWLAMTTTQEANFCGYRERKCQIE 438

  Fly   307 IDVPRM-----------NPQIPLFQQQLVQEMFERILFIWAIRHPASGYVQGINDLVTPFFIVFL 360
            .||.|.           ||.:.|.|         .||..:.:.:...|||||::||:.|...:  
  Fly   439 KDVKRTDRSLQFFAGEDNPNLTLLQ---------GILMTYVMYNFDLGYVQGMSDLLAPILEI-- 492

  Fly   361 QEALTPNTDLEKYDMSTLPEETRNIIEADSFWCLSKFLDCIQDNYIFAQLGIQEKVNQLKDLIQR 425
                                   .:.|.|:|||...|::.:..|:...|.|::.:..|::.||:.
  Fly   493 -----------------------QVNEVDTFWCFVGFMELVFTNFDIDQAGMKTQFAQIRRLIEF 534

  Fly   426 IDVNLHRHLQAHGVDYLQFSFRWMNNLLTRELPLHCTIRLWD---TYLAESDGFALFHLYVCAAF 487
            .:..|..::::|..|.:.|.|||:.....|||.....::||:   |.|...:    |||....|.
  Fly   535 ANAPLFNYMRSHDSDNMYFCFRWLLVWYKRELNSEDVLKLWECLWTRLPCPN----FHLLFSVAI 595

  Fly   488 L-----------LHWKEQLMQQNDFQG 503
            |           ..:.|.|...|:..|
  Fly   596 LDQETRVIIDSQYEFTEILKHVNELSG 622

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5745NP_650941.3 TBC 243..496 CDD:214540 66/286 (23%)
Tbc1d15-17NP_001259806.1 DUF3548 37..>191 CDD:192931
TBC 369..598 CDD:214540 65/268 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456570
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.