DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5745 and CG4041

DIOPT Version :9

Sequence 1:NP_650941.3 Gene:CG5745 / 42498 FlyBaseID:FBgn0038855 Length:546 Species:Drosophila melanogaster
Sequence 2:NP_572197.4 Gene:CG4041 / 31422 FlyBaseID:FBgn0029736 Length:819 Species:Drosophila melanogaster


Alignment Length:309 Identity:68/309 - (22%)
Similarity:117/309 - (37%) Gaps:67/309 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 QDSEYE-TKIEKFQVVLDSPQLDLVALKKISWSGVPRKMRAVSWRLLSKYLPPSSERRMAVLESK 277
            :|.||: .::..|..:|.........|::.:...||..:|...|..|.:.:|..|          
  Fly   398 KDIEYQFQRVRLFARLLQGYPHTAEQLQREAAVDVPPLLRGPIWAALLEVVPNGS---------- 452

  Fly   278 RQGYQDLRHNYFRVDSQDETQQDTYRQIHIDVPRMNPQIPLFQQQLVQEMFERILFIWAIRHPAS 342
                      |.::|....|..|  |||.:|:||.:....|...........|:|..|...||..
  Fly   453 ----------YAKIDKFTSTSTD--RQIEVDIPRCHQYDELLSSPDGHRKLRRLLKAWVTAHPQY 505

  Fly   343 GYVQGINDLVTPF-FIVFLQEALTPNTDLEKYDMSTLPEETRNIIEADSFWCLSKFLD------C 400
            .|.||::.|..|| ::.|..|.|                         :|..|.||:.      .
  Fly   506 VYWQGLDSLTAPFLYLNFNNEEL-------------------------AFLSLFKFIPKYLQWFF 545

  Fly   401 IQDNYIFAQLGIQEKVNQLKDLIQRIDVNLHRHLQAHGVDYLQ--FSFRWMNNLLTRELPLHCTI 463
            ::||    ...|:|.:::...|....:..|.:||.:  :.::.  |:..|...:.:...|||..:
  Fly   546 LKDN----SAVIKEYLSKFSQLTAFHEPLLAQHLAS--ISFIPELFAIPWFLTMFSHVFPLHKIL 604

  Fly   464 RLWDTYLAESDGFALFHLYVCAAFLLHWKEQLMQQNDFQGLMLLLQNLP 512
            .|||..:.   |.:.:.|::..|.|...:..|: .:.|...:||..:||
  Fly   605 HLWDKLML---GDSSYPLFIGIAILRQLRSTLL-TSGFNECILLFSDLP 649

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5745NP_650941.3 TBC 243..496 CDD:214540 56/261 (21%)
CG4041NP_572197.4 PKc_like 45..272 CDD:304357
TBC 432..634 CDD:214540 56/257 (22%)
RHOD_Kc 706..810 CDD:238783
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456528
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.