DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbc1d22 and Tbc1d10c

DIOPT Version :10

Sequence 1:NP_650941.3 Gene:Tbc1d22 / 42498 FlyBaseID:FBgn0038855 Length:546 Species:Drosophila melanogaster
Sequence 2:NP_848765.2 Gene:Tbc1d10c / 108995 MGIID:1922072 Length:444 Species:Mus musculus


Alignment Length:269 Identity:63/269 - (23%)
Similarity:97/269 - (36%) Gaps:66/269 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 LDSPQLDLVALKKISW-----------------------SGVPRKMRAVSWRLLSKYLPPSSERR 270
            |..|..||:..:::.|                       .|:|..:||..|.||       ...|
Mouse    50 LCQPSADLIRQREMKWVEMTLHWEKTMSRRYKKVKIQCRKGIPSALRARCWPLL-------CGAR 107

  Fly   271 MAVLESKRQG-YQDLRHNYFRVDSQDETQQDTYRQIHIDVPRMNPQIPLFQQQLVQEMFERILFI 334
            |.  :....| ||:|..........:...:|.:||..:....::|| ...||.|:|     :|..
Mouse   108 MC--QKNNPGTYQELAAAPGDPQWMETIGRDLHRQFPLHEMFVSPQ-GHGQQGLLQ-----VLKA 164

  Fly   335 WAIRHPASGYVQGINDLVTPFFIVFLQEALTPNTDLEKYDMSTLPEETRNIIEADSFWCLSKFLD 399
            :.:..|..||.|...    |...|.|..               ||.|       ::||||.:..:
Mouse   165 YTLYRPEQGYCQAQG----PVAAVLLMH---------------LPPE-------EAFWCLVQICE 203

  Fly   400 CIQDNYIFAQL-GIQEKVNQLKDLIQRIDVNLHRHLQAHGVDYLQFSFRWMNNLLTRELPLHCTI 463
            .....|....: .:|........|::|....:::|||..||..|.:...|...|.||.||....:
Mouse   204 VYLPGYYGPHMEAVQLDAEVFMALLRRQLPRVYKHLQQVGVGPLLYLPEWFLCLFTRSLPFPTVL 268

  Fly   464 RLWDTYLAE 472
            |:||.:|:|
Mouse   269 RIWDAFLSE 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tbc1d22NP_650941.3 TBC 243..496 CDD:214540 59/255 (23%)
Tbc1d10cNP_848765.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
TBC 87..292 CDD:214540 58/232 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 383..444
Interaction with calcineurin. /evidence=ECO:0000250 404..444
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.