DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP93B and ARHGAP25

DIOPT Version :9

Sequence 1:NP_650939.2 Gene:RhoGAP93B / 42496 FlyBaseID:FBgn0038853 Length:1330 Species:Drosophila melanogaster
Sequence 2:XP_016860912.1 Gene:ARHGAP25 / 9938 HGNCID:28951 Length:650 Species:Homo sapiens


Alignment Length:334 Identity:83/334 - (24%)
Similarity:138/334 - (41%) Gaps:67/334 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  1029 TTENP-----------KRDSLIRGWE-----LMAICLSYVPPSPTFQPTLLNYVNRHRDPSFATC 1077
            :|.||           |:.|:::.|:     |.|..|.|.......:|....|:........||.
Human    43 STPNPLERPIKMGWLKKQRSIVKNWQQRYFVLRAQQLYYYKDEEDTKPQGCMYLPGCTIKEIATN 107

  Fly  1078 FMEVSKWPIHVQISHYATVCCRRLDRIGSSG------------------RRMAKKPTVDEVEQAR 1124
            ..|..|:...:..:.:..      :|:|...                  ||:|..|.        
Human   108 PEEAGKFVFEIIPASWDQ------NRMGQDSYVLMASSQAEMEEWVKFLRRVAGTPC-------- 158

  Fly  1125 QQILRNSMFGNTLSEVMDLQKEKFPFRKLPWIQTTLSEHVLLLNGKQTEGIFRVSADVDEVGCMK 1189
                 .::||..|.|.: ..::||....:|.:....:|.: |.:|:..|||||:....:.|..::
Human   159 -----GAVFGQRLDETV-AYEQKFGPHLVPILVEKCAEFI-LEHGRNEEGIFRLPGQDNLVKQLR 216

  Fly  1190 NRLDRWDVPDYKNTLVDAHTPASLLKLWYRELYDPLIPDAYYED---CVNTEDPDKAK---EIVN 1248
            :..|..:.|.:... .|.||.||||||:.|:|.:|::|.:.||.   |....:.|:||   |::.
Human   217 DAFDAGERPSFDRD-TDVHTVASLLKLYLRDLPEPVVPWSQYEGFLLCGQLTNADEAKAQQELMK 280

  Fly  1249 K---LPEINQLVLTYLIHFLQQFAIPEVVSCTKMDSSNLAMVFAPNCLRCTSEDPKVILENARKE 1310
            :   ||..|..:|:|:..||.:..:...|:  ||...|||.|...|.:|...|||.||:....:.
Human   281 QLSILPRDNYSLLSYICRFLHEIQLNCAVN--KMSVDNLATVIGVNLIRSKVEDPAVIMRGTPQI 343

  Fly  1311 MSFMRTLIQ 1319
            ...|..:|:
Human   344 QRVMTMMIR 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP93BNP_650939.2 WW 50..75 CDD:278809
MyTH4 956..1122 CDD:295320 22/126 (17%)
RhoGAP_KIAA1688 1133..1320 CDD:239854 61/196 (31%)
ARHGAP25XP_016860912.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.