DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP93B and ARHGAP24

DIOPT Version :9

Sequence 1:NP_650939.2 Gene:RhoGAP93B / 42496 FlyBaseID:FBgn0038853 Length:1330 Species:Drosophila melanogaster
Sequence 2:NP_001020787.2 Gene:ARHGAP24 / 83478 HGNCID:25361 Length:748 Species:Homo sapiens


Alignment Length:218 Identity:70/218 - (32%)
Similarity:104/218 - (47%) Gaps:19/218 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly  1118 DEVEQARQQI---LRNSMFGNTLSEVMDLQKEKFPFRKLPWIQTTLSEHVLLLNGKQTEGIFRVS 1179
            |.|:..|:.|   ....:||..|.:.:..:| ::..|..|.:.....:.: ...|.:.||:||:.
Human   115 DWVKSIRRVIWGPFGGGIFGQKLEDTVRYEK-RYGNRLAPMLVEQCVDFI-RQRGLKEEGLFRLP 177

  Fly  1180 ADVDEVGCMKNRLDRWDVPDY-KNTLVDAHTPASLLKLWYRELYDPLIPDAYYED---C---VNT 1237
            ...:.|..:::..|..:.|.: .||  |.||.||||||:.|||.:|:||.|.|||   |   ::.
Human   178 GQANLVKELQDAFDCGEKPSFDSNT--DVHTVASLLKLYLRELPEPVIPYAKYEDFLSCAKLLSK 240

  Fly  1238 EDPDKAKEI---VNKLPEINQLVLTYLIHFLQQFAIPEVVSCTKMDSSNLAMVFAPNCLRCTSED 1299
            |:....||:   |..||.:|..:|.|:..||.:  :.......||...|||.||.||.||...||
Human   241 EEEAGVKELAKQVKSLPVVNYNLLKYICRFLDE--VQSYSGVNKMSVQNLATVFGPNILRPKVED 303

  Fly  1300 PKVILENARKEMSFMRTLIQHMD 1322
            |..|:|........|..:|...|
Human   304 PLTIMEGTVVVQQLMSVMISKHD 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP93BNP_650939.2 WW 50..75 CDD:278809
MyTH4 956..1122 CDD:295320 2/3 (67%)
RhoGAP_KIAA1688 1133..1320 CDD:239854 65/196 (33%)
ARHGAP24NP_001020787.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
PH_RhoGap24 18..131 CDD:241530 4/15 (27%)
PH 21..124 CDD:278594 3/8 (38%)
RhoGAP_ARHGAP22_24_25 131..329 CDD:239855 66/202 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 354..476
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 582..641
ATG16 <609..>723 CDD:285778
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.